Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Amphiregulin(AREG)

Recombinant Human Amphiregulin(AREG)

SKU:CSB-CF001986HU

Regular price $1,659.00 USD
Regular price Sale price $1,659.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P15514

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECK YIEHLEAVTCKCQQEYFGERCGEK

Protein Names:Recommended name: Amphiregulin Short name= AR Alternative name(s): Colorectum cell-derived growth factor Short name= CRDGF

Gene Names:Name:AREG Synonyms:SDGF ANDName: AREGB

Expression Region:101-184

Sequence Info:Full length protein

View full details