Gene Bio Systems
Recombinant Human Adiponectin receptor protein 1(ADIPOR1)
Recombinant Human Adiponectin receptor protein 1(ADIPOR1)
SKU:CSB-CF001367HU
Couldn't load pickup availability
Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Cardiovascular
Uniprot ID: Q96A54
Gene Names: ADIPOR1
Organism: Homo sapiens (Human)
AA Sequence: MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Expression Region: 1-375aa
Sequence Info: Full Length
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 62.6 kDa
Alternative Name(s): Progestin and adipoQ receptor family member I
Relevance: Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin
Reference: "PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif." Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J.M., Emtage P.C., Funk W.D. J. Mol. Evol. 61:372-380(2005)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
