Recombinant Human adenovirus C serotype 5  Early E3B 14.6 kDa protein

Recombinant Human adenovirus C serotype 5 Early E3B 14.6 kDa protein

CSB-CF356845HIL
Regular price
$1,076.00 USD
Sale price
$1,076.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)

Uniprot NO.:P06498

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SPTSKPQRHISCRFTRIWNIPSCYNEKSDLSEAWLYAIISVMVFCSTILALAIYPYLDIG WKRIDAMNHPTFPAPAMLPLQQVVAGGFVPANQPRPTSPTPTEISYFNLTGGDD

Protein Names:Recommended name: Early E3B 14.6 kDa protein

Gene Names:

Expression Region:19-132

Sequence Info:full length protein