Gene Bio Systems
Recombinant Human adenovirus B serotype 7 Early E3B 14.9 kDa protein
Recombinant Human adenovirus B serotype 7 Early E3B 14.9 kDa protein
SKU:CSB-CF323339HII
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human adenovirus B serotype 7 (HAdV-7) (Human adenovirus 7)
Uniprot NO.:P15136
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:STATRATPEQLRKCKFQQPWSFLDCYHEKSDFPTYWIVIVGIINILSCTFFSITIYPTFN FGWNSPNALGYPQEPDEHIPLQHIQQPLALVEYENEPQPSLPPAISYFNLTGGDD
Protein Names:Recommended name: Early E3B 14.9 kDa protein
Gene Names:
Expression Region:20-134
Sequence Info:full length protein
