Recombinant Human adenovirus B serotype 3  Early E3B 14.5 kDa protein

Recombinant Human adenovirus B serotype 3 Early E3B 14.5 kDa protein

CSB-CF318848HIG
Regular price
$1,097.00 USD
Sale price
$1,097.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human adenovirus B serotype 3 (HAdV-3) (Human adenovirus 3)

Uniprot NO.:P11316

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATRATPEQLRKCKFQQPWSFLDCYHEKSDFPTYWIVIVGIINILSCTFFSITIYPTFNFG WNSPNALGYPQEPDEHIPLQHIQQPLALVQYENEPQPSLPPAISYFNLTGGDD

Protein Names:Recommended name: Early E3B 14.5 kDa protein Alternative name(s): Early E3B 15.2 kDa glycoprotein

Gene Names:

Expression Region:22-134

Sequence Info:full length protein