Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Activator of apoptosis harakiri(HRK)

Recombinant Human Activator of apoptosis harakiri(HRK)

SKU:CSB-CF010741HU

Regular price $1,670.00 USD
Regular price Sale price $1,670.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O00198

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAP APGALPTYWPWLCAAAQVAALAAWLLGRRNL

Protein Names:Recommended name: Activator of apoptosis harakiri Alternative name(s): BH3-interacting domain-containing protein 3 Neuronal death protein DP5

Gene Names:Name:HRK Synonyms:BID3

Expression Region:1-91

Sequence Info:Full length protein

View full details