Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2), partial

SKU: P31213

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cell Biology

Uniprot ID: P31213

Gene Names: SRD5A2

Alternative Name(s): (5 alpha-SR2)(SR type 2)(Steroid 5-alpha-reductase 2)(S5AR 2)(Type II 5-alpha reductase)

Abbreviation: Recombinant Human SRD5A2 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 29-71aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-KSI-tagged

Target Protein Sequence: KPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQ

MW: 20.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.

Reference: "Biochemical and pharmacogenetic dissection of human steroid 5 alpha-reductase type II." Makridakis N.M., di Salle E., Reichardt J.K. Pharmacogenetics 10: 407-413(2000)

Function: