Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human 28S ribosomal protein S16, mitochondrial(MRPS16)

Recombinant Human 28S ribosomal protein S16, mitochondrial(MRPS16)

SKU:CSB-EP897105HU

Regular price $1,081.00 USD
Regular price Sale price $1,081.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: Q9Y3D3

Gene Names: MRPS16

Organism: Homo sapiens (Human)

AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

Expression Region: 1-137aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 38.5 kDa

Alternative Name(s):

Relevance:

Reference: "Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28S small subunit." Suzuki T., Terasaki M., Takemoto-Hori C., Hanada T., Ueda T., Wada A., Watanabe K. J. Biol. Chem. 276:33181-33195(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details