Skip to product information
1 of 1

Gene Bio Systems

Recombinant Horse Major allergen Equ c 1

Recombinant Horse Major allergen Equ c 1

SKU:CSB-EP839158HO

Regular price $1,244.00 USD
Regular price Sale price $1,244.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q95182

Gene Names: N/A

Organism: Equus caballus (Horse)

AA Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA

Expression Region: 16-187aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 36.1 kDa

Alternative Name(s): Allergen: Equ c 1

Relevance:

Reference: "cDNA cloning and sequencing reveal the major horse allergen Equ c1 to be a glycoprotein member of the lipocalin superfamily."Gregoire C., Rosinski-Chupin I., Rabillon J., Alzari P.M., David B., Dandeu J.-P.J. Biol. Chem. 271:32951-32959(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details