GeneBio Systems
Recombinant Hordeum vulgare Nucleotide pyrophosphatase/phosphodiesterase (npp)
Recombinant Hordeum vulgare Nucleotide pyrophosphatase/phosphodiesterase (npp)
SKU:Q687E1
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q687E1
Gene Names: npp
Alternative Name(s):
Abbreviation: Recombinant Hordeum vulgare Nucleotide pyrophosphatase/phosphodiesterase protein
Organism: Hordeum vulgare (Barley)
Source: E.coli
Expression Region: 1-368aa
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: AAVRASPDLLGSRGEDTASDGSVVWAKPYTFRAPPTPGQNSLQRIIVFGDMGKAERDGSNEFANYQPGSLNTTDRLIEDLDNYDIVFHIGDMPYANGYLSQWDQFTAQVAPISAKKPYMVASGNHERDWPNTGGFFDVKDSGGECGVPAETMYYYPAENRANFWYKVDYGMFRFCVGDSEHDWREGTPQYKFIEECLSTVDRKHQPWLIFTAHRVLGYSSNSWYADQGSFEEPEGRESLQKLWQRYRVDIAYFGHVHNYERTCPLYQSQCVNADKTHYSGTMNGTIFVVAGGGGSHLSSYTTAIPKWSIFRDHDYGFTKLTAFNHSSLLFEYMKSSDGKVYDSFTIHRDYRDVLSCVHDSCFPTTLAS
MW: 49.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20ā/-80ā. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20ā/-80ā. The shelf life of lyophilized form is 12 months at -20ā/-80ā.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
Relevance: Hydrolyzes pyrophosphate, phosphodiester and phosphosulfate linkages of nucleotide-sugars, sulfonucleotides and nucleoside di and triphosphates. Highest activity observed with the substrates ADP-glucose and adenosine 5'-phosphosulfate.
Reference: "Cloning, expression and characterization of a glycosylated nucleotide pyrophosphatase/phosphodiesterase occurring in chloroplasts that belongs to a widely distributed group of plant nucleotide hydrolases." Nanjo Y., Rodriguez-Lopez M., Munoz F.J., Kurokawa S., Baroja-Fernandez E., Mitsui T., Pozueta-Romero J. Submitted (AUG-2003)
Function:
