Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hordeum vulgare Low molecular mass early light-inducible protein HV60, chloroplastic

Recombinant Hordeum vulgare Low molecular mass early light-inducible protein HV60, chloroplastic

SKU:CSB-CF320446HWQ

Regular price $1,722.00 USD
Regular price Sale price $1,722.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hordeum vulgare (Barley)

Uniprot NO.:P14896

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VRAQTEGPNAPPPNKPKASTSIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLL SQLGSGTGQAWFAYTVAMLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMIGLVAL AATEIITGTPFINV

Protein Names:Recommended name: Low molecular mass early light-inducible protein HV60, chloroplastic Short name= ELIP

Gene Names:

Expression Region:34-167

Sequence Info:full length protein

View full details