Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hordeum vulgare Cytochrome c oxidase subunit 5C(COX5C)

Recombinant Hordeum vulgare Cytochrome c oxidase subunit 5C(COX5C)

SKU:CSB-CF674843HWQ

Regular price $1,485.00 USD
Regular price Sale price $1,485.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hordeum vulgare (Barley)

Uniprot NO.:Q42841

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AGGRVAHATLKGPSVVKEIFIGLTLGLVAGGMWKMHHWNEQRKTRSFYDMLEKGQISVVV EE

Protein Names:Recommended name: Cytochrome c oxidase subunit 5C Alternative name(s): Cytochrome c oxidase polypeptide Vc

Gene Names:Name:COX5C Synonyms:COXVC

Expression Region:2-63

Sequence Info:full length protein

View full details