Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-20, chloroplastic(LHC Ib-20)

Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-20, chloroplastic(LHC Ib-20)

SKU:CSB-CF657782HWQ

Regular price $1,804.00 USD
Regular price Sale price $1,804.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hordeum vulgare (Barley)

Uniprot NO.:Q36718

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AKGSWLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLI PEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSSTYVEIRRWQDIKNPGSVNQDPI FKSYSLPPHECGYPGRVFNPLNFAPLENKEKELANGRLAMLAFLGFLVQHNVHGKGPFEN LQQHLADPWHNTIIQTISGQ

Protein Names:Recommended name: Chlorophyll a-b binding protein 1B-20, chloroplastic Alternative name(s): LHCI type I CAB-1B-20 Light-harvesting complex I 20 kDa protein

Gene Names:Name:LHC Ib-20

Expression Region:32-231

Sequence Info:full length protein

View full details