Skip to product information
1 of 1

Gene Bio Systems

Recombinant Homoserine-homoserine lactone efflux protein(rhtB)

Recombinant Homoserine-homoserine lactone efflux protein(rhtB)

SKU:CSB-CF835192SWW

Regular price $1,810.00 USD
Regular price Sale price $1,810.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella typhi

Uniprot NO.:Q8Z3B4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFEWWFAYLLTSTLLSLSPGSGAINTMTTSINHGYRGAAASIAGLQTGLGIHIVLVGVG LGTLFSRSLIAFEILKWAGAAYLIWLGIQQWRAAGAIDLHTLAQTQSRGRLFKRAIFVNL TNPKSIVFLAALFPQFIMPQQPQLAQYLILGVTTIVVDMIVMTGYATLAQRIAAWIKGPK QMKALNKAFGSLFMLVGALLASARHA

Protein Names:Recommended name: Homoserine/homoserine lactone efflux protein

Gene Names:Name:rhtB Ordered Locus Names:STY3599, t3337

Expression Region:1-206

Sequence Info:full length protein

View full details