Recombinant Hirudo medicinalis Hirudin variant-1

SKU: CSB-RP182644Ba

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P01050

Gene Names: N/A

Organism: Hirudo medicinalis (Medicinal leech)

AA Sequence: VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ

Expression Region: 1-65aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 34 kDa

Alternative Name(s):

Relevance: Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen.

Reference: Role of interactions involving C-terminal nonpolar residues of hirudin in the formation of the thrombin-hirudin complex.Betz A., Hofsteenge J., Stone S.R.Biochemistry 30:9848-9853(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.