Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Hepatitis C virus (isolate HC-J2) (HCV)
Uniprot NO.:P27959
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TTHVTGGATGHTTSGIASLFLPGASQKIQLINTNGSWHINRTALNCNDSLNTGFLAALFY THKFNASGCPERLASCRSIDGFDQGWGPITYTEPGDSDQKPYCWHYAPQRCSVVSAADVC GPVYCFTPSP
Protein Names:Recommended name: Genome polyprotein Cleaved into the following 4 chains: 1. Core protein p21 Alternative name(s): Capsid protein C p21 Core protein p19 Envelope glycoprotein E1 Alternative name(s): gp32 gp35 Envelope g
Gene Names:
Expression Region:384-513
Sequence Info:full length protein