Gene Bio Systems
Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein(S)
Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein(S)
SKU:CSB-CF333496HEB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Hepatitis B virus genotype C subtype adr (isolate China/NC-1/1988) (HBV-C)
Uniprot NO.:P30019
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGP CKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
Protein Names:Recommended name: Small envelope protein Alternative name(s): S glycoprotein S-HBsAg Short name= SHB Small S protein Small surface protein
Gene Names:Name:S
Expression Region:1-226
Sequence Info:full length protein
