Gene Bio Systems
Recombinant Heme transporter hrg-6(hrg-6)
Recombinant Heme transporter hrg-6(hrg-6)
SKU:CSB-CF771998CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:Q7YTM7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRWSLCCHINVRIAYTICGIIIGLFWACVYIFAWKNWVALAACLTATAFAFETFYFYLSV KRDTILNWKSQTFQVLFWINLIVGFLSIGGMITAIVLAATKHQGVSNKDQHGLNWWSTAT WFLVMLKWTWQNAFIARYYGKLLTKSIIHPEEPDDPSTWKF
Protein Names:Recommended name: Heme transporter hrg-6 Alternative name(s): Heme-responsive gene 6 protein Short name= CeHRG-6
Gene Names:Name:hrg-6 ORF Names:F36H1.10
Expression Region:1-161
Sequence Info:full length protein
