Skip to product information
1 of 1

Gene Bio Systems

Recombinant Heme transporter hrg-1(hrg-1)

Recombinant Heme transporter hrg-1(hrg-1)

SKU:CSB-CF632423CXY

Regular price $1,796.00 USD
Regular price Sale price $1,796.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q21642

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHQIYSSDVSSITSKSSIAKAEIITMEEEQQRQSCCTWFHSLKVQIWIAWLGVSAGVMAG TVFAIQYQNWIAVTMCFISSGFATLVLHLHLAYKKTQMAGWSETRLRCLAAVGATVSFLS FIAMVFCLVVAGIEHQTLDKQGLMGANLWIAAVWFFMTSKWSALTWRFARKYRAFCEESQ PLLAAAPPEYSVTI

Protein Names:Recommended name: Heme transporter hrg-1 Alternative name(s): Heme-responsive gene 1 protein Short name= CeHRG-1

Gene Names:Name:hrg-1 ORF Names:R02E12.6

Expression Region:1-194

Sequence Info:full length protein

View full details