Skip to product information
1 of 1

GeneBio Systems

Recombinant Helicobacter pylori LPP20 lipoprotein (lpp20)

Recombinant Helicobacter pylori LPP20 lipoprotein (lpp20)

SKU:P0A0V1

Regular price $1,070.00 USD
Regular price Sale price $1,070.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P0A0V1

Gene Names: lpp20

Alternative Name(s):

Abbreviation: Recombinant Helicobacter pylori lpp20 protein

Organism: Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99)

Source: E.coli

Expression Region: 22-175aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: CSHAPKSGISKSNKAYKEATKGAPDWVVGDLEKVAKYEKYSGVFLGRAEDLITNNDVDYSTNQATAKARANLAANLKSTLQKDLENEKTRTVDASGKRSISGTDTEKISQLVDKELIASKMLARYVGKDRVFVLVGLDKQIVDKVREELGMVKK

MW: 24.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Could play a role in the pathogenesis of H.pylori by serving as an inflammatory mediator.

Reference: "Helicobacter pylori antigenic Lpp20 is a structural homologue of Tipalpha and promotes epithelial-mesenchymal transition." Vallese F., Mishra N.M., Pagliari M., Berto P., Codolo G., de Bernard M., Zanotti G. Biochim Biophys Acta Gen Subj 1861: 3263-3271(2017)

Function:

View full details