Skip to product information
1 of 1

Gene Bio Systems

Recombinant Helicobacter pylori Bacterial non-heme ferritin(ftnA)

Recombinant Helicobacter pylori Bacterial non-heme ferritin(ftnA)

SKU:CSB-YP009053HUV

Regular price $1,412.00 USD
Regular price Sale price $1,412.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P52093

Gene Names:ftnA

Organism:Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

AA Sequence:MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS

Expression Region:1-167aa

Sequence Info:Full length

Source:Yeast

Tag Info:N-terminal 10xHis-tagged

MW:21.8 kDa

Alternative Name(s):pfr

Relevance:Iron-storage protein.

Reference:"Paracrystalline inclusions of a novel ferritin containing nonheme iron, produced by the human gastric pathogen Helicobacter pylori: evidence for a third class of ferritins." Frazier B.A., Pfeifer J.D., Russell D.G., Falk P., Olsen A.N., Hammar M., Westblom T.U., Normark S.J. J. Bacteriol. 175:966-972(1993)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Iron-storage protein.

Involvement in disease:

Subcellular Location:Cytoplasm

Protein Families:Ferritin family, Prokaryotic subfamily

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?heo:C694_03375

STRING Database Link:https://string-db.org/network/85962.HP0653

OMIM Database Link:

Lead Time Guidance:25-35 business days

View full details