Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haloquadratum walsbyi Putative metal transport protein HQ3622A(HQ3622A)

Recombinant Haloquadratum walsbyi Putative metal transport protein HQ3622A(HQ3622A)

SKU:CSB-CF619259HAAE

Regular price $1,643.00 USD
Regular price Sale price $1,643.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haloquadratum walsbyi (strain DSM 16790)

Uniprot NO.:Q18EC3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASIVGYAEPLENAAKMTGATDAAMNLNPGVLPDYTVGGFSGPIGTLISAGVGTVLTLIVA FGAGRLLES

Protein Names:Recommended name: Putative metal transport protein HQ3622A

Gene Names:Ordered Locus Names:HQ3622A

Expression Region:33-101

Sequence Info:full length protein

View full details