Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haloferax volcanii Glycosyltransferase AglI(aglI)

Recombinant Haloferax volcanii Glycosyltransferase AglI(aglI)

SKU:CSB-CF520394HTU

Regular price $1,922.00 USD
Regular price Sale price $1,922.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)

Uniprot NO.:D4GYH2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADSPFPCVSVIVPVYNDPTGIRDTLTALTKQTYPTERVNILPIDNGSTDETRDVIRQFE REHENVTLVVEDEIQGSYAARNTGIEQATGEIFAFVDADMYMDESWLETAVDAMDEAAYV GCDIELVTNGEDTLPARFDAQTAFPIAQYIRQQQYAPTCGLLVSREVVDDVGPFDERLVS GGDSEFGSRVANAGYRQAFAPAATLYHPVRDSFSSLVKKELRVGRGLCQRQEYYADRFGR PGIPPRPSGVKSPDEESSGLDFERLLFGVLSVVMTGVRALGYYREYVRYVRGNTR

Protein Names:Recommended name: Glycosyltransferase AglI EC= 2.4.1.- Alternative name(s): Archaeal glycosylation protein I

Gene Names:Name:aglI Ordered Locus Names:HVO_1528

Expression Region:1-295

Sequence Info:full length protein

View full details