Skip to product information
1 of 1

Gene Bio Systems

Recombinant Halobacterium salinarum Protein CrcB homolog 2(crcB2)

Recombinant Halobacterium salinarum Protein CrcB homolog 2(crcB2)

SKU:CSB-CF867291HTM

Regular price $1,716.00 USD
Regular price Sale price $1,716.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Uniprot NO.:Q9HNW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGIPLRIDARSTALVAVGGAVGAVLRYTVAQAIAGPLGTLAANAAGSLALGALAYEAAAT DSVLSADAHTLLGTGCLSAFTTYSTFAVQTAGLAPRWMAANVATTYALGFAGVLVGRAIA ATARGDRR

Protein Names:Recommended name: Protein CrcB homolog 2

Gene Names:Name:crcB2 Ordered Locus Names:VNG_1921H

Expression Region:1-128

Sequence Info:full length protein

View full details