Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hahella chejuensis ATP synthase subunit a 2(atpB2)

Recombinant Hahella chejuensis ATP synthase subunit a 2(atpB2)

SKU:CSB-CF651773HAAI

Regular price $1,896.00 USD
Regular price Sale price $1,896.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Hahella chejuensis (strain KCTC 2396)

Uniprot NO.:Q2S6N5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGENPTASEYIQHHLQNLTFGNHPEHGWSFAHTAQEAKEMGFWAVHVDSLGWSIALGAL FVWLFRKAAVKATSGVPSGLQNFVEIMVDFVDKSVKETFHGKNAVIAPLALTVFCWIFLM NLMDLVPVDFLPRLFQVITGDDHAYFKVVPTTDVNVTLGMSLSVFFLIIYYSIKVKGVGG FLGELTLQPFGKWMLPFNLLLEGVGLIAKPISLALRLFGNLYAGELLFILIALMPFWAQW ALSVPWAIFHILVIVLQAFIFMMLTIVYLSMAHEDH

Protein Names:Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2

Gene Names:Name:atpB2 Ordered Locus Names:HCH_07078

Expression Region:1-276

Sequence Info:full length protein

View full details