Gene Bio Systems
Recombinant Haemophilus phage HP1 Uncharacterized 23.2 kDa protein in int-C1 intergenic region
Recombinant Haemophilus phage HP1 Uncharacterized 23.2 kDa protein in int-C1 intergenic region
SKU:CSB-CF344732HAN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus phage HP1 (Bacteriophage HP1)
Uniprot NO.:P51700
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKNLFYALKEHWQIYVGLLLGLIIGLLVGVGFTDWKSLVRGLDSKVTDWISSLSTLIIMC FTAVGVMSWKKQKTPDLKSKVAKNIIDFDTHAVLLPSKKFQSIDEIKEYNAIQLKIFWDI EHSLSTLYMFDKSNKQEIDTILGYLLKDINSATSLIEKHARYDEVGRYQLVSLINNGYKN TYPNTTKLFELVVGKSNVVGLNGSS
Protein Names:Recommended name: Uncharacterized 23.2 kDa protein in int-C1 intergenic region Alternative name(s): ORF1
Gene Names:
Expression Region:1-205
Sequence Info:full length protein
