Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus parasuis serovar 5 Probable intracellular septation protein A (HAPS_0470)

Recombinant Haemophilus parasuis serovar 5 Probable intracellular septation protein A (HAPS_0470)

SKU:CSB-CF490523HTD

Regular price $1,787.00 USD
Regular price Sale price $1,787.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haemophilus parasuis serovar 5 (strain SH0165)

Uniprot NO.:B8F486

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQLLEFIPLILFFVVYKTYGVQEAALVLVAATVVQFIALQLLYKKIEKNQWIMGIAVVF FGLLTAYFNDLAFLKWKVTIVNAIFAVALLVSQYVFKKPLIQMLLGKELKLPQNVWEKLN LGWAGFFIFCMIINIIISEFFSDDVWANFKVFGLTGLSLIAVIGTGLYLYPHLKQLEQKE ENNGNTN

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:HAPS_0470

Expression Region:1-187

Sequence Info:full length protein

View full details