
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Uniprot NO.:P45019
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKNKYLTLVALSGFFCVALGAFAAHGLSHILEAKALSWIDTGLEYQMFHTIAVLAVALSA LRDNKFARLSMSSWLIGILLFSGSLYALAFEASNVIVWITPIGGTLFLIGWISLAYGSFK SKSL
Protein Names:Recommended name: UPF0382 membrane protein HI_1073
Gene Names:Ordered Locus Names:HI_1073
Expression Region:1-124
Sequence Info:full length protein