Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae UPF0114 protein CGSHiEE_00455 (CGSHiEE_00455)

Recombinant Haemophilus influenzae UPF0114 protein CGSHiEE_00455 (CGSHiEE_00455)

SKU:CSB-CF403745HSD

Regular price $1,784.00 USD
Regular price Sale price $1,784.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain PittEE)

Uniprot NO.:A5U9Y4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINV NDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVL KVKLSMSIIGISSIHMLQTFVNASNMPEKTMMWQLLLHLGFLVSAIALAYTDKILYSTSH KTH

Protein Names:Recommended name: UPF0114 protein CGSHiEE_00455

Gene Names:Ordered Locus Names:CGSHiEE_00455

Expression Region:1-183

Sequence Info:full length protein

View full details