Recombinant Haemophilus influenzae  Putative uncharacterized protein HI_1475(HI_1475)

Recombinant Haemophilus influenzae Putative uncharacterized protein HI_1475(HI_1475)

CSB-CF690953HTA
Regular price
$1,080.00 USD
Sale price
$1,080.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Uniprot NO.:Q57380

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVFNMRSTRGIFSSFESGYRFASYTLELSPFKTLIKIEIPMCWKPLVCASVLAWSRAIGE FGATLMLAGATRFKTETLPMAVYLNISSGDFEIAIGASLWLLFISSCLLLVLRMINRAV

Protein Names:Recommended name: Putative uncharacterized protein HI_1475

Gene Names:Ordered Locus Names:HI_1475

Expression Region:1-119

Sequence Info:full length protein