Gene Bio Systems
Recombinant Haemophilus influenzae Fumarate reductase subunit D(frdD)
Recombinant Haemophilus influenzae Fumarate reductase subunit D(frdD)
SKU:CSB-CF337983HTA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Uniprot NO.:P44891
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVDQNPKRSGEPPVWLMFGAGGTVSAIFLPVVILIIGLLLPFGLVDVHNLITFAYSWIGK LVILVLTIFPMWCGLHRIHHGMHDLKVHVPAGGFIFYGLATIYTVWVLFAVINL
Protein Names:Recommended name: Fumarate reductase subunit D
Gene Names:Name:frdD Ordered Locus Names:HI_0832
Expression Region:1-114
Sequence Info:full length protein
