Skip to product information
1 of 1

GeneBio Systems

Recombinant Gymnema sylvestre Gurmarin

Recombinant Gymnema sylvestre Gurmarin

SKU:P25810

Regular price $1,037.00 USD
Regular price Sale price $1,037.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P25810

Gene Names: N/A

Alternative Name(s): (Sweet taste-suppressing peptide)

Abbreviation: Recombinant Gymnema sylvestre Gurmarin protein

Organism: Gymnema sylvestre (Gurmar) (Periploca sylvestris)

Source: E.coli

Expression Region: 1-35aa

Protein Length: Full Length

Tag Info: N-terminal 6xHis-KSI-tagged

Target Protein Sequence: QQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG

MW: 19.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Suppresses strongly the sweet taste responses in the rat with high specificity to sucrose, glucose, glycine, and saccharin. This effect is reversible, but complete recovery of the suppressed responses required at least 3h. Gurmarin showed no effect or only a very weak effect on the sweet taste sensation in humans.

Reference: "High-resolution solution structure of gurmarin, a sweet-taste-suppressing plant polypeptide." Fletcher JI, Dingley AJ, Smith R, Connor M, Christie MJ, King GF. Eur. J. Biochem. 264 525-33 (1999)

Function:

View full details