Gene Bio Systems
Recombinant Guinea pig 5-hydroxytryptamine receptor 2B(HTR2B)
Recombinant Guinea pig 5-hydroxytryptamine receptor 2B(HTR2B)
SKU:CSB-CF010888GU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Cavia porcellus (Guinea pig)
Uniprot NO.:P97267
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CNQSTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYKATKSVKTVRKCS NKIYFRNPMTENSKFFMKHGMRNGINSTMYQSPVRL
Protein Names:Recommended name: 5-hydroxytryptamine receptor 2B Short name= 5-HT-2B Short name= 5-HT2B Alternative name(s): Serotonin receptor 2B
Gene Names:Name:HTR2B
Expression Region:1-96
Sequence Info:full length protein
