Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gracilaria tenuistipitata var. liui ATP synthase subunit b, chloroplastic(atpF)

Recombinant Gracilaria tenuistipitata var. liui ATP synthase subunit b, chloroplastic(atpF)

SKU:CSB-CF724538GBAK

Regular price $1,842.00 USD
Regular price Sale price $1,842.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gracilaria tenuistipitata var. liui (Red alga)

Uniprot NO.:Q6B8R0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSCIQVFSVIANFDTDYNLSISFNTDFLEANVINILLLLLGLMYVLKEFLGSILVDRQE KVLLAIQESEERLKQANSRLSESEKQLAQTQMVIAQIIKEAETTAQKVRQSILDQGKADV DKLISASKASIATAEVQIKQQIQLQVTSLAIKRVTMQLQDQITPNIQTRIIDNNIAQLGG YL

Protein Names:Recommended name: ATP synthase subunit b, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I

Gene Names:Name:atpF Ordered Locus Names:Grc000144

Expression Region:1-182

Sequence Info:full length protein

View full details