Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gossypium hirsutum V-type proton ATPase 16 kDa proteolipid subunit(CVA16-2)

Recombinant Gossypium hirsutum V-type proton ATPase 16 kDa proteolipid subunit(CVA16-2)

SKU:CSB-CF669276GHB

Regular price $1,760.00 USD
Regular price Sale price $1,760.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)

Uniprot NO.:Q43434

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit

Gene Names:Name:CVA16-2 ANDName: CVA16-4

Expression Region:1-165

Sequence Info:full length protein

View full details