GeneBio Systems
Recombinant Gossypium hirsutum Transcription factor bHLH84-like (LOC107908183)
Recombinant Gossypium hirsutum Transcription factor bHLH84-like (LOC107908183)
SKU:A0A1U8JKW4
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: A0A1U8JKW4
Gene Names: LOC107908183
Alternative Name(s):
Abbreviation: Recombinant Gossypium hirsutum LOC107908183 protein
Organism: Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Source: E.coli
Expression Region: 1-272aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: MDSMGTLLEGDWSCFSGMYTTEQEADFMAQLLSNCPQLPDIDMSNYLSDSNPVFVTNNSPISMDFCMEDGTNTSFFLVEPDDCLNPEMGKDGNVEKEPKPEPEKKSSNKRSRNSGDVHVQKTKRNGRSKKNQTIAANDDEDGNGGLNGQSWASCSSEDDSNGGANSGSKGEATLNLNGKTRASRGAATDPQSLYARKRRERINERLRILQNLVPNGTKVDISTMLEEAVQYVKFLQLQIKLLSSDDLWMYAPIAYNGMDIGIDLKVGTAKRT
MW: 45.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20ā/-80ā. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20ā/-80ā. The shelf life of lyophilized form is 12 months at -20ā/-80ā.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
Relevance:
Reference: "Genome sequence of cultivated Upland cotton (Gossypium hirsutum TM-1) provides insights into genome evolution." Li F., Fan G., Lu C., Xiao G., Zou C., Kohel R.J., Ma Z., Shang H., Ma X., Wu J., Liang X., Huang G., Percy R.G., Liu K., Yang W., Chen W., Du X., Shi C. Yu S. Nat. Biotechnol. 33: 524-530(2015)
Function:
