
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Uniprot NO.:P27518
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RRTVKSAPTSIWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNREL EVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSI LAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNG RLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNAWAYATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein 151, chloroplastic Alternative name(s): LHCII type II CAB-151 Short name= LHCP
Gene Names:Name:CAB-151
Expression Region:38-265
Sequence Info:full length protein
You may also like
-
Recombinant Pisum sativum Chlorophyll a-b binding protein 215, chloroplastic(CAB215)
- Regular price
- $1,684.00 USD
- Sale price
- $1,684.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Gossypium hirsutum Chloroplast envelope membrane protein(cemA)
- Regular price
- $1,685.00 USD
- Sale price
- $1,685.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Gossypium hirsutum ATP synthase subunit a, chloroplastic(atpI)
- Regular price
- $1,702.00 USD
- Sale price
- $1,702.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Gossypium hirsutum Photosystem II CP43 chlorophyll apoprotein(psbC)
- Regular price
- $1,944.00 USD
- Sale price
- $1,944.00 USD
- Regular price
-
- Unit price
- per
Sold out