Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial(NDUFB5)

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial(NDUFB5)

SKU:CSB-CF609494GGZ-GB

Regular price $1,734.00 USD
Regular price Sale price $1,734.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gorilla gorilla gorilla (Lowland gorilla)

Uniprot NO.:Q0MQD7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYV PEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDG PWYYYETIDKELIDHSPKATPDN

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial Alternative name(s): Complex I-SGDH Short name= CI-SGDH NADH-ubiquinone oxidoreductase SGDH subunit

Gene Names:Name:NDUFB5

Expression Region:47-189

Sequence Info:full length protein

View full details