Skip to product information
1 of 1

GeneBio Systems

Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A)

Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A)

SKU:P27580

Regular price $700.00 USD
Regular price Sale price $700.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P27580

Gene Names: cya

Alternative Name(s): ATP pyrophosphate-lyase;Adenylyl cyclase

Abbreviation: Recombinant Glutamicibacter nicotianae cya protein (D403A)

Organism: Glutamicibacter nicotianae (Arthrobacter nicotianae)

Source: E.coli

Expression Region: 1-403aa(D403A)

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: MSTEHTNTPRADSPQSAAEAVRGARQHAPAATPAESDPILELAEAMEGPLRIPAHTPEAVRDTVASLEKRLIGGQREFRRREVASEAGVSLHSARKLWRAIGFPELSDDEVFFTEADKKALGTMVGMVREGALTEETAISLMRSVGQMTDRMVVWQIEALVEDMIANQNLSDRQARRQLFSLLPEIIPAIEDLLLYSWRRQLNSAVHRMALRVETGVAAYNQDRGEDDGGTPLPLARAVGFADLVSYTSLSRRMNERTLAQLVQRFEAKCAEIISVGGGRLVKTIGDEVLYVAETPQAGAQIALSLSRELAKDELFPQTRGAVVWGRLLSRLGDIYGPTVNMAARLTSLAEPGTVLTDAITANTLRNDARFVLTAQEITAVRGFGDIQPYELSAGEGAGLVID

MW: 50.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Plays essential roles in regulation of cellular metabolism by catalyzing the synthesis of a second messenger, cAMP.

Reference:

Function:

View full details