Skip to product information
1 of 1

Gene Bio Systems

Recombinant Glutamate transport system permease protein gluC(gluC)

Recombinant Glutamate transport system permease protein gluC(gluC)

SKU:CSB-CF851388CQG

Regular price $1,839.00 USD
Regular price Sale price $1,839.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Corynebacterium efficiens

Uniprot NO.:Q8RQL5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTLWADLGPSLLPAFWVTIQLTVYSAIGSMILGTILTAMRVSPVKILRSISTAYINTVR NTPLTLVILFCSFGLYQNLGLTLAGRDSSTFLADNNFRLAVLGFILYTSAFVAESLRSGI NTVHFGQAEAARSLGLGFSDIFRSIIFPQAVRAAIIPLGNTLIALTKNTTIASVIGVGEA SLLMKSTIENHANMLFVVFAIFAVGFMILTLPMGLGLGKLAEKMAVKK

Protein Names:Recommended name: Glutamate transport system permease protein gluC

Gene Names:Name:gluC Ordered Locus Names:CE1846

Expression Region:1-228

Sequence Info:full length protein

View full details