Skip to product information
1 of 1

Gene Bio Systems

Recombinant Geophagus steindachneri Cytochrome c oxidase subunit 2(mt-co2)

Recombinant Geophagus steindachneri Cytochrome c oxidase subunit 2(mt-co2)

SKU:CSB-CF015073GBN

Regular price $1,489.00 USD
Regular price Sale price $1,489.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geophagus steindachneri (Red hump earth eater)

Uniprot NO.:P29657

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAHPSQLGFQDAASPMMEELLHFHDHALMVVFLISTFVLYIILTMLTTKLTDKLILESHE IEII

Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II

Gene Names:Name:mt-co2 Synonyms:coii, coxii, mtco2

Expression Region:1-64

Sequence Info:full length protein

View full details