Recombinant Geobacter uraniireducens  NADH-quinone oxidoreductase subunit A 2(nuoA2)

Recombinant Geobacter uraniireducens NADH-quinone oxidoreductase subunit A 2(nuoA2)

CSB-CF402590GEI
Regular price
$1,087.00 USD
Sale price
$1,087.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)

Uniprot NO.:A5G9B9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLGAYLPIIVLVVVAVLFGCGSLIFSSLIGQKKPSVVKMAPYECGCEPVGSARERFSIKF YIIAMLFILFDIEAVFLYPWAVLFKRLGMFGLMEMGVFIVILFVGYIYVWKKGALEWE

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 2 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 2 NDH-1 subunit A 2 NUO1 2

Gene Names:Name:nuoA2 Ordered Locus Names:Gura_4244

Expression Region:1-118

Sequence Info:full length protein