Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)
Uniprot NO.:A5G9B9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLGAYLPIIVLVVVAVLFGCGSLIFSSLIGQKKPSVVKMAPYECGCEPVGSARERFSIKF YIIAMLFILFDIEAVFLYPWAVLFKRLGMFGLMEMGVFIVILFVGYIYVWKKGALEWE
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 2 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 2 NDH-1 subunit A 2 NUO1 2
Gene Names:Name:nuoA2 Ordered Locus Names:Gura_4244
Expression Region:1-118
Sequence Info:full length protein