Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Uniprot NO.:Q74GY4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAYAFKKNGLLKPFVSTAAICLLVAGTVVLCHASGGGEGAHHVDTGKQMKDFMWRVIDFI ALAGVIVWALKKANAKGALADRSANVEKALREAEEARTAAEKKFAEYSEKLEKANQEIDG IYAAIRKEGELEKERIIAEARITAEKIREQATATATQEVLKARAELRDEAARLAVQMAEQ ALREAIKKDDQDRLVSEYLTKVENLH
Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b
Gene Names:Name:atpF Ordered Locus Names:GSU0109
Expression Region:1-206
Sequence Info:full length protein