Gene Bio Systems
Recombinant Geobacter metallireducens NADH-quinone oxidoreductase subunit A 1(nuoA1)
Recombinant Geobacter metallireducens NADH-quinone oxidoreductase subunit A 1(nuoA1)
SKU:CSB-CF658698GBJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Uniprot NO.:Q39ZC5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQQTTVANHSLFPTLPPEFLPLALYTVAATVLIGVLLLAAWWLGAKTTNRNKELPYESGV IPTGSARLAYPVPFYLIAIFFIVFDVEAAFIFAWATAWRELGLAGLIHITFFIVILLLGL VWLWMKGGLDWGPSRERR
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 1 NDH-1 subunit A 1 NUO1 1
Gene Names:Name:nuoA1 Ordered Locus Names:Gmet_0152
Expression Region:1-138
Sequence Info:full length protein
