Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacillus thermodenitrificans (strain NG80-2)
Uniprot NO.:A4IKL9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGIKYSSKINKIRTFALSLIFVGVIVMYLGLFFRTSPIIMTLFMVLGLLFLVASGIVYFW IGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEGKEFDEKYNKKRKN
Protein Names:Recommended name: UPF0295 protein GTNG_0491
Gene Names:Ordered Locus Names:GTNG_0491
Expression Region:1-117
Sequence Info:full length protein