Skip to product information
1 of 1

Gene Bio Systems

Recombinant Geobacillus sp. UPF0059 membrane protein GWCH70_3318 (GWCH70_3318)

Recombinant Geobacillus sp. UPF0059 membrane protein GWCH70_3318 (GWCH70_3318)

SKU:CSB-CF512850GFJ

Regular price $1,852.00 USD
Regular price Sale price $1,852.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Geobacillus sp. (strain WCH70)

Uniprot NO.:C5D9N0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKMFIGELVALSMMAFALGMDAFSVALGMGLFRLQLKQIFYIGIMIGLFHIIMPFLGMFL GRFLSYQFGSIASYIGGALLLLLGIQMIVTSFKKESDRFVSPMGIGLIFFAFSVSLDSFS VGLSLGIYGVRILLTILLFGFFSTVLTWMGLMLGRHFQQWLGAYSEALGGSILLAFGLKL LFSF

Protein Names:Recommended name: UPF0059 membrane protein GWCH70_3318

Gene Names:Ordered Locus Names:GWCH70_3318

Expression Region:1-184

Sequence Info:full length protein

View full details