Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gamma-secretase subunit pen-2(pen-2)

Recombinant Gamma-secretase subunit pen-2(pen-2)

SKU:CSB-CF880030CXY

Regular price $1,681.00 USD
Regular price Sale price $1,681.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q9U357

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDISKLTDVKKVDLCKKYFLIGACFLPLVWIVNTFWFFSDAFCKPINAHRRQIRKYVIAS IVGSIFWIIVLSAWEIFFQHYRAQGLVWTDFLTFVFPTGRV

Protein Names:Recommended name: Gamma-secretase subunit pen-2 Alternative name(s): Presenilin enhancer protein 2

Gene Names:Name:pen-2 ORF Names:T28D6.9

Expression Region:1-101

Sequence Info:full length protein

View full details