Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gallid herpesvirus 2 Protein UL20 homolog(MDV032)

Recombinant Gallid herpesvirus 2 Protein UL20 homolog(MDV032)

SKU:CSB-CF755268GAN

Regular price $1,845.00 USD
Regular price Sale price $1,845.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)

Uniprot NO.:Q77MS4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKHGFGYYATEANEYTIPLDDIDDGRSDTDAKTLGSVLTQLSEEVDWDDAVDYATMSSY LGDYVFTIPNSYDIHPKFTRYVVLFGLSTFVLRPSCCLIFLFYAIYAQDNRFLILGTTIT AFFYGTLMLEMYYMYANIKYDLMPLSKFQQVLIGALSMLGPIIFVAISYNMIFKDVTFMK KILAFDTNLKTSGFVIYLVMIASLAYSITSISDAIGFLLPRLWTRAVLKSCVPF

Protein Names:Recommended name: Protein UL20 homolog

Gene Names:Name:MDV032

Expression Region:1-234

Sequence Info:full length protein

View full details