Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gallid herpesvirus 2 Envelope protein UL45 homolog(UL45H)

Recombinant Gallid herpesvirus 2 Envelope protein UL45 homolog(UL45H)

SKU:CSB-CF340478GAM

Regular price $1,861.00 USD
Regular price Sale price $1,861.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallid herpesvirus 2 (strain bc-1) (GaHV-2) (Marek's disease herpesvirus type 1)

Uniprot NO.:P22652

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMSPTPEDDRDLVVVRGRLRMMDNGAEHDRERRSYTAWPHLCCGCTIGIILTMFVIATTL LLASLFAFSYMSLESGTCPKEWIGLGYSCMRVAGNNATELEALDMCAQHNSKLIDFTNAK TLVEAIVPFGSTNASFGNIFRLRDSRSTCILPTIGGPISVDCPRTCSVVCQRPRPLSTTA SIIRDARIYLRLERRDYYEVYSSILSNAIMK

Protein Names:Recommended name: Envelope protein UL45 homolog

Gene Names:Name:UL45H

Expression Region:1-211

Sequence Info:full length protein

View full details