Recombinant  Fumarate reductase subunit C(frdC)

Recombinant Fumarate reductase subunit C(frdC)

CSB-CF372443EJE
Regular price
$1,106.00 USD
Sale price
$1,106.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O1:K1 / APEC

Uniprot NO.:A1AJ60

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW

Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein

Gene Names:Name:frdC Ordered Locus Names:Ecok1_42060 ORF Names:APECO1_2237

Expression Region:1-131

Sequence Info:full length protein